PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG009756.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 421aa    MW: 46657.2 Da    PI: 7.0077
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG009756.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.64.9e-32276331156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k r++W+peLH++Fv+a++qLGG+++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  CCG009756.1 276 KHRRCWSPELHRQFVNALQQLGGAQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 331
                  68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.3E-29273334IPR009057Homeodomain-like
PROSITE profilePS5129413.648273333IPR017930Myb domain
SuperFamilySSF466898.43E-18274334IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-26276331IPR006447Myb domain, plants
PfamPF002491.2E-7278329IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MGSVPPELSL DFVRPSSTTK TFTSAIKKFT FLPETITDFL KEVSMIGDAA VKGLKIDSFL  60
NDLEEEKRKI DAFKRELPLC MLLLNDAIQV VREELMQCGT SINQQPVLEE FIPLKKKIDD  120
HGDDRESDGL IKEKDSKDKK SWMSSVQLWI TDDHHPSTDY LFDAKQNFKL ESKTNKKANQ  180
YVNEDAFQAC KGRTAAGTFM PFKAYPGSLR KEDDSNREEL PVPALSLLTP GIKSIKEESN  240
STGSRSSCSR SVSTTAPNSE SNLRNGPQSQ QQSSRKHRRC WSPELHRQFV NALQQLGGAQ  300
VATPKQIREL MQVDGLTNDE VKSHLQKYRL HTRRVAPATA SAPANQSAIV LGGLWMAQDQ  360
YGDSSKANSS KSGSPQGPLQ LAVNTGGTST TGGDSMEDDE DAKSEGYSWK SHIHRSGKED  420
V
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1475970.0EF147597.1 Populus trichocarpa clone WS0123_L02 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011001195.10.0PREDICTED: two-component response regulator-like APRR2
RefseqXP_011001194.10.0PREDICTED: two-component response regulator-like APRR2
TrEMBLB9N4V00.0B9N4V0_POPTR; Uncharacterized protein
STRINGPOPTR_0004s15220.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-55G2-like family protein